PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G017200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 307aa    MW: 31591.7 Da    PI: 5.4001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G017200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.5e-082067244
                        SSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrw 44
                        g+WT e ++ + +av+ +  +      +W++ a+ +  g+t+ +++ ++
  Sevir.3G017200.1.p 20 GAWTREQEKAFENAVATMAEDgddgdaRWEKLAEAVE-GKTADEVRRHY 67
                        89*****************99****************.**********9 PP

2Myb_DNA-binding39.71.1e-12133177347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Sevir.3G017200.1.p 133 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 177
                         6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.9921471IPR017877Myb-like domain
SMARTSM007172.0E-51873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-42068IPR009057Homeodomain-like
PfamPF002492.6E-62068IPR001005SANT/Myb domain
SuperFamilySSF466891.36E-82277IPR009057Homeodomain-like
CDDcd001672.25E-62267No hitNo description
PROSITE profilePS5129416.605126182IPR017930Myb domain
SuperFamilySSF466892.32E-16128183IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-17130180IPR006447Myb domain, plants
SMARTSM007179.3E-11130180IPR001005SANT/Myb domain
CDDcd001673.38E-10133178No hitNo description
Gene3DG3DSA:1.10.10.601.0E-10133176IPR009057Homeodomain-like
PfamPF002493.5E-11133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAVEEASSSG GGGDGEEGSG AWTREQEKAF ENAVATMAED GDDGDARWEK LAEAVEGKTA  60
DEVRRHYEFL VEDVEGIDSG RVPLPTYAAD GGAEEGGTGG GGGGGKKGSG GGGGHGEKGS  120
AKSVEQERRK GIAWTEDEHR LFLLGLEKYG KGDWRSISRN FVISRTPTQV ASHAQKYFIR  180
LNSINRERRR SSIHDITSVN NGDASAVQGP ITGQTNGQAA NPGKPSKQSP QPANAPPGVD  240
AYGTTIGQPV GGPLVSAVGT PVTLPVPAPP HMAYGMHTPV PGAVVPGAPV NIAPMPYPMP  300
PPSSHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-161892678RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103111GGKKGSGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794430.0HF679443.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB37 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960078.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-59DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3Z8920.0K3Z892_SETIT; Uncharacterized protein
STRINGSi022762m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-74MYB family protein